PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009607100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 317aa    MW: 36260.7 Da    PI: 6.6203
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009607100.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+++++ +G+g+W+   +  g+ R++k+c++rw +yl
   XP_009607100.1 14 KGPWTPEEDQKLIEYIQVHGPGNWRNLHKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.98.4e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  +G++ W++Ia++++ gRt++++k++w+++
   XP_009607100.1  67 RGRFSFEEEETIIQLHSVFGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.117965IPR017930Myb domain
SuperFamilySSF466891.32E-3111108IPR009057Homeodomain-like
SMARTSM007179.5E-151363IPR001005SANT/Myb domain
PfamPF002493.2E-161461IPR001005SANT/Myb domain
CDDcd001671.72E-121661No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129420.07266116IPR017930Myb domain
SMARTSM007176.3E-1666114IPR001005SANT/Myb domain
PfamPF002492.6E-1567111IPR001005SANT/Myb domain
CDDcd001675.68E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MGRTPCCDKN GLKKGPWTPE EDQKLIEYIQ VHGPGNWRNL HKNAGLQRCG KSCRLRWTNY  60
LRPDIRRGRF SFEEEETIIQ LHSVFGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHRPRL DFLDLSSLLN STQLNLSSLL GLQALVNPEI LKLANSLLVP QTENPELLLQ  180
KIQENQLLNG QLQNSQGPNI LNNQTSIFQY NNQLHNQVPE IPNCTPNVSC SSSHQSMNGP  240
IFQENMMLPL QYYSNYSASD ASENSTFRSL NSSSNQNSQN FSFDTPLSSG IEEEKESYCS  300
NFMKFEIPES LDFDDLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-301211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2447215e-51AC244721.5 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-58o17 map 10, complete sequence.
GenBankHG9755225e-51HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009607100.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLK4CY471e-158K4CY47_SOLLC; Uncharacterized protein
TrEMBLM1CJ441e-158M1CJ44_SOLTU; Uncharacterized protein
STRINGSolyc10g008700.1.11e-157(Solanum lycopersicum)
STRINGPGSC0003DMT4000684811e-157(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.14e-90MYB-like 102